PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_001575-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 322aa    MW: 35795.9 Da    PI: 6.9065
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_001575-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g++R+ k+c++rw +yl
  AHYPO_001575-RA 14 KGPWTPEEDIILVSYIQEHGPGNWRAVPTNTGLRRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.91.5e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  AHYPO_001575-RA  67 RGNFTEKEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.663965IPR017930Myb domain
SuperFamilySSF466898.39E-3111108IPR009057Homeodomain-like
SMARTSM007178.3E-151363IPR001005SANT/Myb domain
PfamPF002491.6E-161461IPR001005SANT/Myb domain
CDDcd001678.67E-111661No hitNo description
Gene3DG3DSA:1.10.10.606.1E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129420.24966116IPR017930Myb domain
SMARTSM007171.9E-1566114IPR001005SANT/Myb domain
PfamPF002499.2E-1567112IPR001005SANT/Myb domain
CDDcd001674.01E-1069111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRPPCCDKI GVKKGPWTPE EDIILVSYIQ EHGPGNWRAV PTNTGLRRCS KSCRLRWTNY  60
LRPGIKRGNF TEKEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKLE  120
EGQDGQNTSS QEGFSSNSTS STSSSHNSNK GQWERRLQTD INMAKQALCE ALSIEKPDLG  180
SGMGPSPSPN PNPNPALYAS SAENIARLLE NWMTRKPNSN GSFSSTLQST QNNYSNKKIN  240
CLDNDEFKSL LSFNSNSNSN SSITTTDASL QSASVAVAEA EEQKLPLSLL EKWLFEDGVI  300
NQDQVNMMDM SLDAENADDL F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-261411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678525.11e-144PREDICTED: myb-related protein 306
SwissprotP813921e-115MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0J8CB331e-144A0A0J8CB33_BETVU; Uncharacterized protein
STRINGVIT_17s0000g06190.t011e-123(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.12e-99myb domain protein 94